
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:P92697
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFVLALTVNTLLALLLMTITFWLPQLYPYMEKSDPYECGFDPAYPARIPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNLPLMTTSSLMLIIILALGLTYEWSQKGLDWAE
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3
Gene Names:Name:MT-ND3 Synonyms:MTND3, NADH3, ND3
Expression Region:1-115
Sequence Info:full length protein
You may also like
-
Recombinant Pongo pygmaeus NADH-ubiquinone oxidoreductase chain 3(MT-ND3)
- Regular price
- €1.027,95 EUR
- Sale price
- €1.027,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
- Regular price
- €1.014,95 EUR
- Sale price
- €1.014,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 6(MT-ND6)
- Regular price
- €1.072,95 EUR
- Sale price
- €1.072,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3(NDUFA3)
- Regular price
- €1.005,95 EUR
- Sale price
- €1.005,95 EUR
- Regular price
-
- Unit price
- per
Sold out