Gene Bio Systems
Recombinant Pongo abelii Epithelial membrane protein 1(EMP1)
Recombinant Pongo abelii Epithelial membrane protein 1(EMP1)
SKU:CSB-CF007648PYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RCY3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Protein Names:Recommended name: Epithelial membrane protein 1 Short name= EMP-1
Gene Names:Name:EMP1
Expression Region:1-157
Sequence Info:full length protein
