Gene Bio Systems
Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)
Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)
SKU:CSB-CF735780PYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RBB4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVRLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Short name= Oligosaccharyl transferase subunit DAD1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= DAD
Gene Names:Name:DAD1
Expression Region:2-113
Sequence Info:full length protein
