Skip to product information
1 of 1

Gene Bio Systems

Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066(Bpro_0066)

Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066(Bpro_0066)

SKU:CSB-CF619670PAAI

Regular price €1.342,95 EUR
Regular price Sale price €1.342,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Polaromonas sp. (strain JS666 / ATCC BAA-500)

Uniprot NO.:Q12HF9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKYAIIFAVISLIAGALGFGGVAAGAAGIAKILFGLFLILAVIFVVLAALGVGAVRKGM K

Protein Names:Recommended name: UPF0391 membrane protein Bpro_0066

Gene Names:Ordered Locus Names:Bpro_0066

Expression Region:1-61

Sequence Info:full length protein

View full details