Skip to product information
1 of 1

Gene Bio Systems

Recombinant Polaromonas sp. ATP synthase subunit c(atpE)

Recombinant Polaromonas sp. ATP synthase subunit c(atpE)

SKU:CSB-CF622545PAAI

Regular price €1.215,95 EUR
Regular price Sale price €1.215,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Polaromonas sp. (strain JS666 / ATCC BAA-500)

Uniprot NO.:Q12GQ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHVLGFVALAAGLIIGLGAVGACIGIGIMGSKYLEAAARQPELMNELQTKMFLLAGLID AAFLIGVGIAMMFAFANPFVLK

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:Bpro_0322

Expression Region:1-82

Sequence Info:full length protein

View full details