Skip to product information
1 of 1

Gene Bio Systems

Recombinant Podospora anserina Protein GET1(GET1)

Recombinant Podospora anserina Protein GET1(GET1)

SKU:CSB-CF461940EXJ

Regular price €1.486,95 EUR
Regular price Sale price €1.486,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)

Uniprot NO.:B2B0S1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLLIIFVTELVVQLVNTLGATTINDLLWRIYLTLPTPLSLEFAQQRRKQKEYLAVRH ELKATSSQDEFAKWAKLRRQHDKLLEDLEKKKASLEAARTKFDRTLTTTRTVSTRSVQWF LPFWYSKEPMFWLPYGWFPYYVEWFASFPRAPMGSVSIVVWQWACTAVIALMIEAATAAL VYVAAKQSQKIRQPVPAQSEKKDS

Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 ORF Names:Pa_3_7110

Expression Region:1-204

Sequence Info:full length protein

View full details