Skip to product information
1 of 1

Gene Bio Systems

Recombinant Podospora anserina Golgi apparatus membrane protein TVP23(TVP23)

Recombinant Podospora anserina Golgi apparatus membrane protein TVP23(TVP23)

SKU:CSB-CF463884EXJ

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)

Uniprot NO.:B2ALT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEQPQPAPGSLSWRLSSHPITLLTFLGFRVSSLLVYLFGLLFTDNLVMIFIITILLLAAD FYYLKNIAGRRLVGLRWWNEVDPSTGDSHWVFESSEPGSKVINATDSRFFWIAIYAQPLF WIALAVVAVFSFKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNIAGSAFNGGNLAGSI ASNMVGRFFTR

Protein Names:Recommended name: Golgi apparatus membrane protein TVP23

Gene Names:Name:TVP23 ORF Names:Pa_1_13630

Expression Region:1-191

Sequence Info:full length protein

View full details