Skip to product information
1 of 1

Gene Bio Systems

Recombinant Plasmodium berghei L-lactate dehydrogenase(PB000185.00.0)

Recombinant Plasmodium berghei L-lactate dehydrogenase(PB000185.00.0)

SKU:CSB-EP307560EWN

Regular price €1.016,95 EUR
Regular price Sale price €1.016,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Metabolism

Uniprot ID: Q7SI97

Gene Names: PB000185.00.0

Organism: Plasmodium berghei (strain Anka)

AA Sequence: MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI

Expression Region: 1-316aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 39.4 kDa

Alternative Name(s):

Relevance:

Reference: "Crystal structure of Plasmodium berghei lactate dehydrogenase indicates the unique structural differences of these enzymes are shared across the Plasmodium genus." Winter V.J., Cameron A., Tranter R., Sessions R.B., Brady R.L. Mol. Biochem. Parasitol. 131:1-10(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details