Gene Bio Systems
Recombinant Pisum sativum NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic(ndhF)
Recombinant Pisum sativum NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic(ndhF)
SKU:CSB-CF656863EWE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pisum sativum (Garden pea)
Uniprot NO.:Q32905
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPSIMTGIAL IGIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALL FLGS
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 5 NADH-plastoquinone oxidoreductase subunit 5
Gene Names:Name:ndhF Synonyms:ndh5
Expression Region:1-124
Sequence Info:full length protein
