
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pisum sativum (Garden pea)
Uniprot NO.:P27490
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSK NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 8, chloroplastic Alternative name(s): LHCII type I CAB-8
Gene Names:Name:CAB8 Synonyms:LHCB1
Expression Region:37-268
Sequence Info:full length protein
You may also like
-
Recombinant Pisum sativum Chlorophyll a-b binding protein AB80, chloroplastic(AB80)
- Regular price
- €1.112,95 EUR
- Sale price
- €1.112,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pisum sativum Chlorophyll a-b binding protein 215, chloroplastic(CAB215)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pisum sativum Chlorophyll a-b binding protein AB96(AB96)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cucumis sativus Chlorophyll a-b binding protein of LHCII type I, chloroplastic
- Regular price
- €1.111,95 EUR
- Sale price
- €1.111,95 EUR
- Regular price
-
- Unit price
- per
Sold out