Gene Bio Systems
Recombinant Pig Zinc transporter SLC39A7(SLC39A7)
Recombinant Pig Zinc transporter SLC39A7(SLC39A7)
SKU:CSB-CF639972PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q29175
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HSHHPLEQPRHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHG TRMEVMAWKTGVSSKEKQSSEEEEKEAGASRKRRGGSTRPKDGPVRPQHSGEEKQGQTCV CQGIILTTMTVLLHEVPHEVGDFAILVQSGCSKKQ
Protein Names:Recommended name: Zinc transporter SLC39A7 Alternative name(s): Histidine-rich membrane protein Ke4 Solute carrier family 39 member 7
Gene Names:Name:SLC39A7 Synonyms:HKE4
Expression Region:1-155
Sequence Info:full length protein
