Gene Bio Systems
Recombinant Pig Tetraspanin-31(TSPAN31)
Recombinant Pig Tetraspanin-31(TSPAN31)
SKU:CSB-CF644910PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q29257
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVCGGFACSKNALCALNVVYMLVGLLLIGVAAWAKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFGISCSCLAINLSKQAGIIN
Protein Names:Recommended name: Tetraspanin-31 Short name= Tspan-31 Alternative name(s): Sarcoma-amplified sequence homolog
Gene Names:Name:TSPAN31 Synonyms:SAS
Expression Region:1-109
Sequence Info:full length protein
