Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Reactive oxygen species modulator 1(ROMO1)

Recombinant Pig Reactive oxygen species modulator 1(ROMO1)

SKU:CSB-CF020063PI

Regular price €1.354,95 EUR
Regular price Sale price €1.354,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:A1XQR6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGPFSCLRIGMRGRELMGGIGKTM MQSGGTFGPFMAIGMGIRC

Protein Names:Recommended name: Reactive oxygen species modulator 1 Short name= ROS modulator 1 Alternative name(s): Protein MGR2 homolog

Gene Names:Name:ROMO1

Expression Region:1-79

Sequence Info:Full length protein

View full details