Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Membrane cofactor protein(CD46)

Recombinant Pig Membrane cofactor protein(CD46)

SKU:CSB-CF004939PI

Regular price €1.600,95 EUR
Regular price Sale price €1.600,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O02839

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CDEPPKFESMRPQFLNTTYRPGDRVEYECRPGFQPMVPALPTFSVCQDDNTWSPLQEACRRKACSNLPDPLNGQVSYPNGDMLFGSKAQFTCNTGFYIIGAETVYCQVSGNVMAWSEPSPLCEKILCKPPGEIPNGKYTNSHKDVFEYNEVVTYSCLSSTGPDEFSLVGESSLFCIGKDEWSSDPPECKVVKCPYPVVPNGEIVSGFGSKFYYKAEVVFKCNAGFTLHGRDTIVCGANSTWEPEMPQCIKDSKPTDPPATPGPSHPGPPSPSDASPPKDAESLDGGIIAAIVVGVLAAIAVIAGGVYFFHHKYNKKRSK

Protein Names:Recommended name: Membrane cofactor protein Alternative name(s): CD_antigen= CD46

Gene Names:Name:CD46 Synonyms:MCP

Expression Region:45-363

Sequence Info:full length protein

View full details