Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Melatonin receptor type 1A(MTNR1A)

Recombinant Pig Melatonin receptor type 1A(MTNR1A)

SKU:CSB-CF015189PI

Regular price €1.437,95 EUR
Regular price Sale price €1.437,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O02781

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA

Protein Names:Recommended name: Melatonin receptor type 1A Short name= Mel-1A-R Short name= Mel1a receptor

Gene Names:Name:MTNR1A

Expression Region:1-154

Sequence Info:Full length protein

View full details