Gene Bio Systems
Recombinant Pig Melatonin receptor type 1A(MTNR1A)
Recombinant Pig Melatonin receptor type 1A(MTNR1A)
SKU:CSB-CF015189PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:O02781
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA
Protein Names:Recommended name: Melatonin receptor type 1A Short name= Mel-1A-R Short name= Mel1a receptor
Gene Names:Name:MTNR1A
Expression Region:1-154
Sequence Info:Full length protein
