Recombinant Pig Lipocalin-1 (LCN1)

SKU: P53715

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P53715

Gene Names: LCN1

Alternative Name(s): (Tear lipocalin)(Tlc)(Tear prealbumin)(TP)(Von Ebner gland protein)(VEG protein)

Abbreviation: Recombinant Pig LCN1 protein

Organism: Sus scrofa (Pig)

Source: E.coli

Expression Region: 20-176aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: QEFPAVGQPLQDLLGRWYLKAMTSDPEIPGKKPESVTPLILKALEGGDLEAQITFLIDGQCQDVTLVLKKTNQPFTFTAYDGKRVVYILPSKVKDHYILYCEGELDGQEVRMAKLVGRDPENNPEALEEFKEVARAKGLNPDIVRPQQSETCSPGGN

MW: 24.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor.

Reference: "The primary structure and the disulfide links of the bovine relaxin-like factor (RLF)." Bullesbach E.E., Schwabe C. Biochemistry 41: 274-281(2002)

Function: