Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Extracellular calcium-sensing receptor(CASR)

Recombinant Pig Extracellular calcium-sensing receptor(CASR)

SKU:CSB-CF004558PI

Regular price €1.492,95 EUR
Regular price Sale price €1.492,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O62714

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGAFIKFRNTPIVK ATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVAC IFFNKVYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRQRSSSLGGSTGSQQQ PRCKQKVIFGSGTVTFSLSFHEPQKNAM

Protein Names:Recommended name: Extracellular calcium-sensing receptor Short name= CaSR Alternative name(s): Parathyroid cell calcium-sensing receptor Short name= PCaR1

Gene Names:Name:CASR Synonyms:PCAR1

Expression Region:1-208

Sequence Info:Full length protein

View full details