Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Enteropeptidase(TMPRSS15)

Recombinant Pig Enteropeptidase(TMPRSS15)

SKU:CSB-CF018824PI

Regular price €1.344,95 EUR
Regular price Sale price €1.344,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:P98074

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGKSHEARGTMKITSGVTYNPNLQDKLSVDFKVLAFDIQQMIGEIFQSSNLKNEYKNSRVLQFENGSVIVIFDLLFAQWVSDENIKEELIQGIEANKSSQLVAFHIDVNSIDITESL

Protein Names:Recommended name: Enteropeptidase EC= 3.4.21.9 Alternative name(s): Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 3 chains: 1. Enteropeptidase non-catalytic mini chain 2. Enteropeptidase non-catalytic heavy chain 3. Enteropeptidase catalytic light chain

Gene Names:Name:TMPRSS15 Synonyms:ENTK, PRSS7

Expression Region:52-117

Sequence Info:full length protein

View full details