Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Beta-nerve growth factor(NGF)

Recombinant Pig Beta-nerve growth factor(NGF)

SKU:CSB-EP643662PI

Regular price €911,95 EUR
Regular price Sale price €911,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q29074

Gene Names: NGF

Organism: Sus scrofa (Pig)

AA Sequence: SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA

Expression Region: 110-229aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 29.4 kDa

Alternative Name(s): Beta-NGF

Relevance: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular domain ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Reference: "A new marker (NGFB) on pig chromosome 4, isolated by using a consensus sequence conserved among species."Lahbib-Mansais Y., Mellink C., Yerle M., Gellin J.Cytogenet. Cell Genet. 67:120-125(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details