
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:O77737
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK
Protein Names:Recommended name: Bcl-2-like protein 1 Short name= Bcl2-L-1 Alternative name(s): Apoptosis regulator Bcl-X
Gene Names:Name:BCL2L1 Synonyms:BCLX, BLC2L
Expression Region:1-233
Sequence Info:Full length protein
You may also like
-
Recombinant Rat Bcl-2-like protein 1(Bcl2l1)
- Regular price
- €1.117,95 EUR
- Sale price
- €1.117,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Bcl-2-like protein 1(Bcl2l1)
- Regular price
- €1.117,95 EUR
- Sale price
- €1.117,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Apoptosis regulator Bcl-2(Bcl2)
- Regular price
- €1.119,95 EUR
- Sale price
- €1.119,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Chicken Apoptosis regulator Bcl-2(BCL2)
- Regular price
- €1.117,95 EUR
- Sale price
- €1.117,95 EUR
- Regular price
-
- Unit price
- per
Sold out