Skip to product information
1 of 1

Gene Bio Systems

Recombinant Photobacterium profundum UPF0397 protein PBPRA2239(PBPRA2239)

Recombinant Photobacterium profundum UPF0397 protein PBPRA2239(PBPRA2239)

SKU:CSB-CF764390PIG

Regular price €1.458,95 EUR
Regular price Sale price €1.458,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Photobacterium profundum (Photobacterium sp. (strain SS9))

Uniprot NO.:Q6LQ01

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSAKTVVLIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLFGPLVGFLVGF IGHWVTDMFAGWGVWLTWVLGSGLVGLIIGFYPKITRGRLEMGKFTKCDFALFVFLAFLG NVIGYGCSAYLDSVLYAEPFTKVVAQLIIIAAGNTLLIAIVGHYILTAVAKRKQQSYNLK EAD

Protein Names:Recommended name: UPF0397 protein PBPRA2239

Gene Names:Ordered Locus Names:PBPRA2239

Expression Region:1-183

Sequence Info:full length protein

View full details