Skip to product information
1 of 1

Gene Bio Systems

Recombinant Phleum pRatense Pollen allergen Phl p 2(PHLPII)

Recombinant Phleum pRatense Pollen allergen Phl p 2(PHLPII)

SKU:CSB-EP337346GUQ

Regular price €911,95 EUR
Regular price Sale price €911,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: P43214

Gene Names: PHLPII

Organism: Phleum pratense (Common timothy)

AA Sequence: VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Expression Region: 27-122aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 26.8 kDa

Alternative Name(s): Allergen Phl p II Allergen: Phl p 2

Relevance:

Reference: "Molecular characterization of Phl p II, a major timothy grass (Phleum pratense) pollen allergen."Dolecek C., Vrtala S., Laffer S., Steinberger P., Kraft D., Scheiner O., Valenta R.FEBS Lett. 335:299-304(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details