Gene Bio Systems
Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic(atpG)
Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic(atpG)
SKU:CSB-CF371394EUF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Phaeodactylum tricornutum (strain CCAP 1055/1)
Uniprot NO.:A0T0E8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MINISMLISNSEVSGPGGLFDFNATLPLVAIQFILLMVLLNILLYNPLLTIIEERKEYIL TNLGKASELLSEANKLTQQYEQELDNVRKEAQLEITNSQKIHKEILEVELNISQKYIDNL LDTIQKDLLAKKNIALNSLDEIVQSLCVDIEARLSI
Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II
Gene Names:Name:atpG
Expression Region:1-156
Sequence Info:full length protein
