Skip to product information
1 of 1

Gene Bio Systems

Recombinant Peroxisomal coenzyme A diphosphatase ndx-8(ndx-8)

Recombinant Peroxisomal coenzyme A diphosphatase ndx-8(ndx-8)

SKU:CSB-CF885650CXY

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9NA25

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKCVVSRADDLKRMLDLSDVPTKSQGEQDAGVLILLHDDGSEKLKVLLCVRSRQLRRHPG EVCFPGGMMDDEDGQNVRRTAIREAYEEVGVNENDDYLVLGNLPAFRARFGVLIHPTVAL LRRPPTFVLSIGEVESIFWIPLSQFLEDTHHSTFLIDEFYMVHVFQFDEYPTTYGVTALM CIVVAIGLLGKLPNFNLMGNLTISDMLDKHLDSIEIIRHVYEFASRKFEPKSKI

Protein Names:Recommended name: Peroxisomal coenzyme A diphosphatase ndx-8 EC= 3.6.1.- Alternative name(s): Nudix hydrolase 8

Gene Names:Name:ndx-8 ORF Names:Y87G2A.14

Expression Region:1-234

Sequence Info:full length protein

View full details