Gene Bio Systems
Recombinant Penicillium chrysogenum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
Recombinant Penicillium chrysogenum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
SKU:CSB-CF471721ETH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) (Penicillium notatum)
Uniprot NO.:B6H465
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSREPVPSSFDEGNPQFTEETGMQKFTRRLKEEPLVPLGCAATCYALYRAYRSMKSGDSV EMNRMFRARIYAQAFTLVALVAGGMYFKTERQQRREFDQAVELRKKQEKRDAWLRELEIR DKEDREWRERHAAIEAAAKEAGNKAAPRKEPEAARSSIEPADEKSIGVMDAVRALISRN
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:aim31 ORF Names:Pc13g07740
Expression Region:1-179
Sequence Info:full length protein
