Gene Bio Systems
Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains
Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains
SKU:CSB-EP355859PEO
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Penaeus sp. (Penoeid shrimp)
Delivery time: 3-7 business days
Uniprot ID: P02636
AA Sequence: AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKMAVQKHCQGKKYSEFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYDKLTTEDDRKAGGLTLERYQDLYAQFISNPNESCSACFLFGPLKVVQ
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-192aa
Protein length: Full Length
MW: 42.0 kDa
Alternative Name(s):
Relevance: Like parvalbumins, SCP's seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution.
Reference: "Amino acid sequence of alpha chain of sarcoplasmic calcium binding protein obtained from shrimp tail muscle." Takagi T., Konishi K. J. Biochem. 95:1603-1615(1984)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
