Gene Bio Systems
Recombinant Pelophylax nigromaculatus Tyrosinase(TYR)
Recombinant Pelophylax nigromaculatus Tyrosinase(TYR)
SKU:CSB-CF025394PEM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelophylax nigromaculatus (Black-spotted frog) (Rana nigromaculata)
Uniprot NO.:Q04604
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GIDGHRGGRGTHQSNIRIYSDSAPPWFTKEDISAMRFLSDSRIGHIKQNLLLFESDQTPL
Protein Names:Recommended name: Tyrosinase EC= 1.14.18.1 Alternative name(s): Monophenol monooxygenase
Gene Names:Name:TYR Synonyms:TYRS
Expression Region:20-532
Sequence Info:full length protein
