Recombinant Pelodictyon luteolum ATP synthase subunit b 2(atpF2)

SKU: CSB-CF661512PAAP

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum (strain DSM 273))

Uniprot NO.:Q3B143

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTSGNILLAGSLLSPEPGLIFWTTITFVLVLIILKKIAWGPIISALEEREKGIQSSIDR AHGAKEESEAILRQNRELLAKADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAK EEIEQEKRRALAELRNEVADLAVRGAEKIIRGVLDADVQKKVVDSMIQDLSTNRN

Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2

Gene Names:Name:atpF2 Ordered Locus Names:Plut_2096

Expression Region:1-175

Sequence Info:full length protein