Gene Bio Systems
Recombinant Pelobacter propionicus ATP synthase subunit c 2(atpE2)
Recombinant Pelobacter propionicus ATP synthase subunit c 2(atpE2)
SKU:CSB-CF373430PYF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pelobacter propionicus (strain DSM 2379)
Uniprot NO.:A1AP46
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFFSMCVLGAAIGMAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIES LAIYALVICLIILFANPYKDIALKLAETVAK
Protein Names:Recommended name: ATP synthase subunit c 2 Alternative name(s): ATP synthase F(0) sector subunit c 2 F-type ATPase subunit c 2 Short name= F-ATPase subunit c 2 Lipid-binding protein 2
Gene Names:Name:atpE2 Ordered Locus Names:Ppro_1501
Expression Region:1-91
Sequence Info:full length protein
