Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelobacter carbinolicus ATP synthase subunit c 1(atpE1)

Recombinant Pelobacter carbinolicus ATP synthase subunit c 1(atpE1)

SKU:CSB-CF665274PAAO

Regular price €1.370,95 EUR
Regular price Sale price €1.370,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Uniprot NO.:Q3A8L3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFFTWVIITAGFGMAFGSLGTAIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMVES LAIYVFVVSMIILFANPFKDVVLELVAG

Protein Names:Recommended name: ATP synthase subunit c 1 Alternative name(s): ATP synthase F(0) sector subunit c 1 F-type ATPase subunit c 1 Short name= F-ATPase subunit c 1 Lipid-binding protein 1

Gene Names:Name:atpE1 Ordered Locus Names:Pcar_0016

Expression Region:1-88

Sequence Info:full length protein

View full details