Gene Bio Systems
Recombinant Pasteurella multocida UPF0756 membrane protein PM0771(PM0771)
Recombinant Pasteurella multocida UPF0756 membrane protein PM0771(PM0771)
SKU:CSB-CF866539ESG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pasteurella multocida (strain Pm70)
Uniprot NO.:Q9CMP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLQFNTVALLLVVLILLGVLSNNSSVTISAAILLLMQQTFLAKYIPFMEKHGITLGIII LTIGVLSPIVSGKIQLPHLAVFLNWKMWLAVAVGLLVAWLGGRGVGLMGAQPVLLTGLLV GTILGVAFVGGIPVGPLIAAGILSLFLGKS
Protein Names:Recommended name: UPF0756 membrane protein PM0771
Gene Names:Ordered Locus Names:PM0771
Expression Region:1-150
Sequence Info:full length protein
