Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan paniscus Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Recombinant Pan paniscus Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

SKU:CSB-CF727952EQU

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pan paniscus (Pygmy chimpanzee) (Bonobo)

Uniprot NO.:Q69BK6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SHTDVKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVS SMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPTYEFTSDDMVIVG

Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Cytochrome b-c1 complex subunit 5 Rieske iron-sulfur protein Short name= RISP Ubiquinol-cytoc

Gene Names:Name:UQCRFS1

Expression Region:79-274

Sequence Info:full length protein

View full details