Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 5(Os04g0686800, LOC_Os04g59020)

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 5(Os04g0686800, LOC_Os04g59020)

SKU:CSB-CF800039OFG

Regular price €1.496,95 EUR
Regular price Sale price €1.496,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XTL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAMMNNERSSSNKLQVDAENPAAVGDELDLAARANWLRAAVLGANDGLVSTASLMLGVG AVKAEARAMVISGFAGLLAGACSMAIGEFVSVCSQRDVELAQLERDGKRGGEEEKALPSP AQAAAASAMAFSVGAVVPLLAAGFIVNYRLRIAVVVAVASVALAAFGCVGAVLGRAAVAR SSARVVLGGWAAMGITFGLMRLFKASGI

Protein Names:Recommended name: Vacuolar iron transporter homolog 5 Alternative name(s): Protein NODULIN-LIKE 5

Gene Names:Ordered Locus Names:Os04g0686800, LOC_Os04g59020 ORF Names:OSJNBa0070M12.11

Expression Region:1-208

Sequence Info:full length protein

View full details