Recombinant Oryza sativa subsp. japonica Putative bidirectional sugar transporter SWEET7e(SWEET7E)

SKU: CSB-CF387301OFG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:A3BWJ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSPDLIRNVVGIVGNAISFGLFLSPVLTFWRIIKEKDMKYFKADPYLATLLNCMLWVFY GLPIVHPNSILVVTINGIGLVIEAVYLTIFFLFSNKKN

Protein Names:Recommended name: Putative bidirectional sugar transporter SWEET7e Short name= OsSWEET7e

Gene Names:Name:SWEET7E Ordered Locus Names:Os09g0256600, LOC_Os09g08270 ORF Names:OsJ_28561

Expression Region:1-98

Sequence Info:full length protein