Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-2(TIP1-2)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-2(TIP1-2)

SKU:CSB-CF853224OFG

Regular price €1.537,95 EUR
Regular price Sale price €1.537,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q94CS9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIA ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL LKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIG FIVGANILAGGAFDGASMNPAVSFGPAVVTGVWDNHWVYWLGPFVGAAIAALIYDIIFIG QRPHDQLPTADY

Protein Names:Recommended name: Probable aquaporin TIP1-2 Alternative name(s): Tonoplast intrinsic protein 1-2 Short name= OsTIP1;2

Gene Names:Name:TIP1-2 Synonyms:TIP1 Ordered Locus Names:Os01g0975900, LOC_Os01g74450 ORF Names:OsJ_004842, P0459B04.30

Expression Region:1-252

Sequence Info:full length protein

View full details