Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Hydrophobic protein OSR8(OSR8)

Recombinant Oryza sativa subsp. japonica Hydrophobic protein OSR8(OSR8)

SKU:CSB-CF885408OFG

Regular price €1.353,95 EUR
Regular price Sale price €1.353,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q9LRI7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVLVALD SDQYQREYHTLA

Protein Names:Recommended name: Hydrophobic protein OSR8

Gene Names:Name:OSR8 Ordered Locus Names:Os09g0558100, LOC_Os09g38560 ORF Names:OJ1065_E04.3

Expression Region:1-72

Sequence Info:full length protein

View full details