Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic(CAB2R)

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic(CAB2R)

SKU:CSB-CF320959OFG

Regular price €1.516,95 EUR
Regular price Sale price €1.516,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:P12331

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 2, chloroplastic Alternative name(s): LHCII type I CAB-2 Short name= LHCP

Gene Names:Name:CAB2R Ordered Locus Names:Os01g0600900, LOC_Os01g41710 ORF Names:P0518F01.17-1

Expression Region:30-261

Sequence Info:full length protein

View full details