Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 1, chloroplastic(CAB1R)
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 1, chloroplastic(CAB1R)
SKU:CSB-CF319390OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:P12330
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI HAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): LHCII type I CAB-1 Short name= LHCP
Gene Names:Name:CAB1R Ordered Locus Names:Os09g0346500, LOC_Os09g17740 ORF Names:OSJNBb0085I16.35, P0512H04.4
Expression Region:33-265
Sequence Info:full length protein
