Gene Bio Systems
Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0549625(Os11g0549625, LOC_Os11g34730)
Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0549625(Os11g0549625, LOC_Os11g34730)
SKU:CSB-CF646932OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q2R2T4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASSSRTALPSAVLALRLLTLALLAASLAVIAADKLTLDFGGGLPPKKITFKDVYAYRYV LAIAVIGCAYTLLQIPFVAVSIAKRKRMIGGSENVALFLIFADVIFALLVATGAGAGFGL TYDAKSAFGGSKLPGEVVRFFNMAYAAAGLMLLAAAAMALIIMLSIYSLVR
Protein Names:Recommended name: CASP-like protein Os11g0549625
Gene Names:Ordered Locus Names:Os11g0549625, LOC_Os11g34730 ORF Names:OsJ_34213
Expression Region:1-171
Sequence Info:full length protein
