Gene Bio Systems
Recombinant Oryza sativa subsp. japonica CASP-like protein Os08g0536200(Os08g0536200, LOC_Os08g42430)
Recombinant Oryza sativa subsp. japonica CASP-like protein Os08g0536200(Os08g0536200, LOC_Os08g42430)
SKU:CSB-CF757910OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q6Z1G3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVELESQEAVTVASTADIAVDVSLRLLAAATSLAAAVVVAANHQQRWGIRVDFTLFQVWI GFVAVNLVCTVYAAATAAAAARKAMGRWWLHHADAVVVNLEAAATAGAGAIGSIAMWGNE ASGWYAVCRLYRRYCNAGAAALALSLAAVLLLGVACARSRYPKMPPTT
Protein Names:Recommended name: CASP-like protein Os08g0536200
Gene Names:Ordered Locus Names:Os08g0536200, LOC_Os08g42430 ORF Names:OSJNBa0033D24.32, P0665C04.13
Expression Region:1-168
Sequence Info:full length protein
