Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os06g0656300(Os06g0656300, LOC_Os06g44610)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os06g0656300(Os06g0656300, LOC_Os06g44610)

SKU:CSB-CF724232OFG

Regular price €1.482,95 EUR
Regular price Sale price €1.482,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q67W83

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSYMEAAAAARAAEAKTEGLLRGACALLAAAAALLVGLNTQTETVLFIRKKATVKDVQA LWVLAMAAAAAAGYHLLQLLRCFYLSRFADGKPCRHRRAIAWLCFLLDKGCAYITFATTV AAAQACVVALYGTHALQWTKLCNIYTRFCEQVAGSLVCAMLAAVGTALLSVVSARNLFRL YPSMLSPPPSSFVG

Protein Names:Recommended name: CASP-like protein Os06g0656300

Gene Names:Ordered Locus Names:Os06g0656300, LOC_Os06g44610 ORF Names:P0460H04.29, P0709F06.50

Expression Region:1-194

Sequence Info:full length protein

View full details