Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os03g0298300(Os03g0298300, LOC_Os03g18680)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os03g0298300(Os03g0298300, LOC_Os03g18680)

SKU:CSB-CF607473OFG

Regular price €1.493,95 EUR
Regular price Sale price €1.493,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q10MR5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAMVPADADAAAKPPPDVEKPDYSSQNGAPNSAAAAAGGGGGGVVDSVVARWRREDMLDK SPLALHAAAAAFAFVALVLVASNQHGDWMEFDRYQEYRYLLAIAALAFAYSLAQALRHAL RMRRGVDPVPTASGRLLDFASDQVVAYLLMSALSAATPITNRMRSAVINRFTDTTAAAIS MAFLAFVSLALSAIVSGYKLSKQTYM

Protein Names:Recommended name: CASP-like protein Os03g0298300

Gene Names:Ordered Locus Names:Os03g0298300, LOC_Os03g18680

Expression Region:1-206

Sequence Info:full length protein

View full details