Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 6(APRL6)

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 6(APRL6)

SKU:CSB-CF646923OFG

Regular price €1.565,95 EUR
Regular price Sale price €1.565,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q2QP53

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AEPEEARCPRERLPPFVAAAAAAALRPSCRASAERCPAEEINGEELVKELSGKEECTAVL FYASWCPFSQRMRPVFDDLSSMFPRIKHLAVEQTNAMPAVLSRYGVRSFPSILIACGPYA YWPVGSKELDSLVNVYTAVTGQEPIAYLGPRKWSAARTGSTQHVKLWKSSIIEALKSEPY LAFSILFICLKILVAFFPKFFSCIKGIWVQYFRHANLGILAKLTQLLECVPHAVDLRKIW SKCRLMGGAMNSRVWASSLASMSFGERSSPRAAVLD

Protein Names:Recommended name: 5'-adenylylsulfate reductase-like 6 Alternative name(s): Adenosine 5'-phosphosulfate reductase-like 6 Short name= APR-like 6 Short name= OsAPRL6

Gene Names:Name:APRL6 Ordered Locus Names:Os12g0541600, LOC_Os12g35640

Expression Region:25-300

Sequence Info:full length protein

View full details