Gene Bio Systems
Recombinant Oryza sativa subsp. indica Photosystem I reaction center subunit VI, chloroplastic(PSAH)
Recombinant Oryza sativa subsp. indica Photosystem I reaction center subunit VI, chloroplastic(PSAH)
SKU:CSB-CF383728OFF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. indica (Rice)
Uniprot NO.:A2Y7D9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KYGEKSVYFDLEDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAGPFTKRGLLLKFLLLG GGSLVAYVSASASPDLLPIKKGPQLPPTPGPRGKI
Protein Names:Recommended name: Photosystem I reaction center subunit VI, chloroplastic Short name= PSI-H Alternative name(s): Light-harvesting complex I 11 kDa protein Protein GOS5
Gene Names:Name:PSAH Synonyms:GOS5 ORF Names:OsI_020232
Expression Region:48-142
Sequence Info:full length protein
