Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica Chlorophyll a-b binding protein, chloroplastic (OsI_012078)

Recombinant Oryza sativa subsp. indica Chlorophyll a-b binding protein, chloroplastic (OsI_012078)

SKU:CSB-CF384880OFF

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2XJ35

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSI LAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP

Gene Names:ORF Names:OsI_012078

Expression Region:36-263

Sequence Info:full length protein

View full details