Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ophiostoma ulmi CeRato-ulmin(CU)

Recombinant Ophiostoma ulmi CeRato-ulmin(CU)

SKU:CSB-YP313268OBS

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q06153

Gene Names: CU

Organism: Ophiostoma ulmi (Dutch elm disease fungus)

AA Sequence: SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Expression Region: 26-100aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 9.6 kDa

Alternative Name(s): Dutch elm disease toxin

Relevance: Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Reference: "Isolation and characterization of the cerato-ulmin toxin gene of the Dutch elm disease pathogen, Ophiostoma ulmi."Bowden C.G., Hintz W.E., Jeng R., Hubbes M., Horgen P.A.Curr. Genet. 25:323-329(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details