Skip to product information
1 of 1

Gene Bio Systems

Recombinant Onion yellows phytoplasma UPF0397 protein PAM_019(PAM_019)

Recombinant Onion yellows phytoplasma UPF0397 protein PAM_019(PAM_019)

SKU:CSB-CF757893OBN

Regular price €1.470,95 EUR
Regular price Sale price €1.470,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Onion yellows phytoplasma (strain OY-M)

Uniprot NO.:Q6YRJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKDDSIKKTVTIGLSAAIFFVLSCFASIPVGFNVSIETSVAFLAFIAVAFGPAVGFYVG LIGNTIKDFILFGNVSWNWVLCSALIGFIYGLPHKIIDLKYQVFTKKKIVYFWLYQVAFN FIIWGFFAPQSDLLIYGQPPKLVYLQSFLIVISNILAYSVVGIKLMSMYSCHYNKQATLI KINNS

Protein Names:Recommended name: UPF0397 protein PAM_019

Gene Names:Ordered Locus Names:PAM_019

Expression Region:1-185

Sequence Info:full length protein

View full details