Recombinant Onchocerca volvulus OV-16 antigen(OV16),partial

Recombinant Onchocerca volvulus OV-16 antigen(OV16),partial

CSB-EP341251OEG
Regular price
€752,95 EUR
Sale price
€752,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: OV16

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Onchocerca volvulus

Delivery time: 3-7 business days

Uniprot ID: P31729

AA Sequence: KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Tag info: N-terminal 6xHis-tagged

Expression Region: 17-197aa

Protein length: Partial

MW: 24 kDa

Alternative Name(s):

Relevance:

Reference: Identification of an Onchocerca volvulus cDNA encoding a low-molecular-weight antigen uniquely recognized by onchocerciasis patient sera.Lobos E., Altmann M., Mengod G., Weiss N., Rudin W., Karam M.Mol. Biochem. Parasitol. 39:135-146(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Onchocerca volvulus OV-16 antigen(OV16)
    Regular price
    €752,95 EUR
    Sale price
    €752,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Onchocerca volvulus OV-16 antigen(OV16),partial
    Regular price
    €825,95 EUR
    Sale price
    €825,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli CS6 fimbrial subunit B(cssB)
    Regular price
    €752,95 EUR
    Sale price
    €752,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)
    Regular price
    €640,95 EUR
    Sale price
    €640,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share