Recombinant Onchocerca volvulus OV-16 antigen(OV16),partial

CSB-EP341251OEG

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: OV16

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Onchocerca volvulus

Delivery time: 3-7 business days

Uniprot ID: P31729

AA Sequence: KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Tag info: N-terminal 6xHis-tagged

Expression Region: 17-197aa

Protein length: Partial

MW: 24 kDa

Alternative Name(s):

Relevance:

Reference: Identification of an Onchocerca volvulus cDNA encoding a low-molecular-weight antigen uniquely recognized by onchocerciasis patient sera.Lobos E., Altmann M., Mengod G., Weiss N., Rudin W., Karam M.Mol. Biochem. Parasitol. 39:135-146(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.