Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ochrobactrum anthropi ATP synthase subunit a 1(atpB1)

Recombinant Ochrobactrum anthropi ATP synthase subunit a 1(atpB1)

SKU:CSB-CF413041ODH

Regular price €1.524,95 EUR
Regular price Sale price €1.524,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Uniprot NO.:A6WW77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFAL AVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1

Gene Names:Name:atpB1 Ordered Locus Names:Oant_0500

Expression Region:1-249

Sequence Info:full length protein

View full details