Gene Bio Systems
Recombinant Nocardia farcinica UPF0060 membrane protein NFA_36830(NFA_36830)
Recombinant Nocardia farcinica UPF0060 membrane protein NFA_36830(NFA_36830)
SKU:CSB-CF726432NAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nocardia farcinica (strain IFM 10152)
Uniprot NO.:Q5YTG0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVLRSLVLFGLAALAEIGGAWLVWQGWREHRGLWWIAAGVIALGAYGFVATFQPDPDFG RVLAAYGGVFVVGSLAWGVLVDRFRPDRWDLLGAGICLVGVAVIMYAPRGG
Protein Names:Recommended name: UPF0060 membrane protein NFA_36830
Gene Names:Ordered Locus Names:NFA_36830
Expression Region:1-111
Sequence Info:full length protein
